Opsin 1 (Medium Wave) Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP198471

Catalog No. NBP198471

Description

Opsin 1 (Medium Wave) Polyclonal specifically detects Opsin 1 (Medium Wave) in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: Opsin 1 (Medium Wave)
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: GCP, GOP, Green cone photoreceptor pigment, Green-sensitive opsin, medium-wave-sensitive opsin 1, OPN1MW, opsin 1 (cone pigments), medium-wave-sensitive 2
• Host Species: Rabbit
• Molecular Weight of Antigen: 40 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_032132
• Gene Symbols: OPN1MW
• Immunogen: The immunogen for this antibody is Opsin 1 (Medium Wave) - C-terminal region. Peptide sequence CYLQVWLAIRAVAKQQKESESTQKAEKEVTRMVVVMVFAYCLCWGPYTFF.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 2652
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit
• Isotype: IgG