Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
KCP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$499.50
Specifications
Antigen | KCP |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
KCP Polyclonal specifically detects KCP in Human samples. It is validated for Western Blot.Specifications
KCP | |
Polyclonal | |
Rabbit | |
NP_955381 | |
375616 | |
The immunogen for this antibody is KCP - N-terminal region. Peptide sequence AHSSVLAGNSQEQWHPLREWLGRLEAAVMELREQNKDLQTRVRQLESCEC. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
CRIM2, KCP1, kielin/chordin-like protein, NET67 | |
KCP | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title