Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Fucosyltransferase 3/FUT3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | Lewis A Blood Group Antigen |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Fucosyltransferase 3/FUT3 Polyclonal specifically detects Fucosyltransferase 3/FUT3 in Human samples. It is validated for Western Blot.Specifications
Lewis A Blood Group Antigen | |
Polyclonal | |
Rabbit | |
NP_000140 | |
2525 | |
The immunogen for this antibody is FUT3/Blood Group Lewis A - C-terminal region. Peptide sequence: RSNYERFLPPDAFIHVDDFQSPKDLARYLQELDKDHARYLSYFRWRETLR | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
alpha-(1,3/1,4)-fucosyltransferase, Blood group Lewis alpha-4-fucosyltransferase, CD174, EC 2.4.1, EC 2.4.1.65, FT3B, Fucosyltransferase 3, fucosyltransferase 3 (galactoside 3(4)-L-fucosyltransferase, Lewis blood group), Fucosyltransferase III, FucT-III, galactoside 3(4)-L-fucosyltransferase, LEfucosyltransferase 3 (galactoside 3(4)-L-fucosyltransferase, Lewis blood groupincluded), Les, Lewis FT, MGC131739 | |
ABO | |
IgG | |
42 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title