COQ7 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP198495

Catalog No. NBP198495

Description

COQ7 Polyclonal specifically detects COQ7 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: COQ7
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: CAT5, CLK1, CLK-1, Coenzyme Q biosynthesis protein 7 homolog, coenzyme Q, 7 (rat, yeast) homolog, coenzyme Q7 homolog, ubiquinone (yeast), COQ7 coenzyme Q, 7 homolog ubiquinone, placental protein KG-20, Timing protein clk-1 homolog, ubiquinone biosynthesis protein COQ7 homolog
• Host Species: Rabbit
• Molecular Weight of Antigen: 20 kDa
• Quantity: 100 μL
• Research Discipline: Stem Cell Markers
• Gene ID (Entrez): 10229
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_001177912
• Gene Symbols: COQ7
• Immunogen: The immunogen for this antibody is COQ7 - C-terminal region. Peptide sequence MACTVAVEESIAHHYNNQIRTLMEEDPEKYEELLQLIKKFRDEELEHHDI.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Bovine: 86%; Yeast: 82%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Yeast
• Isotype: IgG