Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
COQ7 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | COQ7 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP19849520
|
Novus Biologicals
NBP19849520UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP198495
|
Novus Biologicals
NBP198495 |
100 μL |
Each for $487.50
|
|
|||||
Description
COQ7 Polyclonal specifically detects COQ7 in Human samples. It is validated for Western Blot.Specifications
| COQ7 | |
| Polyclonal | |
| Rabbit | |
| Stem Cell Markers | |
| CAT5, CLK1, CLK-1, Coenzyme Q biosynthesis protein 7 homolog, coenzyme Q, 7 (rat, yeast) homolog, coenzyme Q7 homolog, ubiquinone (yeast), COQ7 coenzyme Q, 7 homolog ubiquinone, placental protein KG-20, Timing protein clk-1 homolog, ubiquinone biosynthesis protein COQ7 homolog | |
| COQ7 | |
| IgG | |
| 20 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_001177912 | |
| 10229 | |
| The immunogen for this antibody is COQ7 - C-terminal region. Peptide sequence MACTVAVEESIAHHYNNQIRTLMEEDPEKYEELLQLIKKFRDEELEHHDI. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title