Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DUSP4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | DUSP4 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
DUSP4 Polyclonal specifically detects DUSP4 in Human samples. It is validated for Western Blot.Specifications
DUSP4 | |
Polyclonal | |
Rabbit | |
Cell Cycle and Replication | |
dual specificity phosphatase 4, Dual specificity protein phosphatase hVH2, EC 3.1.3.16, EC 3.1.3.48, HVH2serine/threonine specific protein phosphatase, MAP kinase phosphatase 2, Mitogen-activated protein kinase phosphatase 2, MKP-2dual specificity protein phosphatase 4, MKP2VH1 homologous phosphatase 2, TYP, VH2 | |
DUSP4 | |
IgG | |
43 kDa |
Western Blot | |
Unconjugated | |
RUO | |
NP_001385 | |
1846 | |
The immunogen for this antibody is DUSP4 - C-terminal region. Peptide sequence GQLLQFESQVLATSCAAEAASPSGPLRERGKTPATPTSQFVFSFPVSVGV. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title