Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. AKR7A2 Antibody, Novus Biologicals™

AKR7A2 Antibody, Novus Biologicals™
SDP

Catalog No. NBP198519 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP198519 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP198519 Supplier Novus Biologicals Supplier No. NBP198519
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

AKR7A2 Polyclonal specifically detects AKR7A2 in Human samples. It is validated for Western Blot.

Specifications

Antigen AKR7A2
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. NP_003680
Gene Alias AFAR1, AFARAFB1-AR1, AFB1 aldehyde reductase 1, AFB1-AR 1, aflatoxin B1 aldehyde reductase member 2, aflatoxin beta1 aldehyde reductase, AKR7, aldo-keto reductase family 7, member A2 (aflatoxin aldehyde reductase), Aldoketoreductase 7, EC 1.1.1.n11, SSA reductase, Succinic semialdehyde reductase
Gene Symbols AKR7A2
Host Species Rabbit
Immunogen The immunogen for this antibody is AKR7A2 - N-terminal region. Peptide sequence SETILGGLGLGLGGGDCRVKIATKANPWDGKSLKPDSVRSQLETSLKRLQ.
Molecular Weight of Antigen 39 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 8574
Test Specificity Zebrafish: 86%; Canine: 79% .
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.