Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
USAG1/SOSTDC1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP19852520UL
Description
USAG1/SOSTDC1 Polyclonal specifically detects USAG1/SOSTDC1 in Human samples. It is validated for Western Blot.Specifications
| USAG1/SOSTDC1 | |
| Polyclonal | |
| Western Blot 1:1000 | |
| NP_056279 | |
| SOSTDC1 | |
| The immunogen for this antibody is SOSTDC1 - C-terminal region. Peptide sequence ITVVTACKCKRYTRQHNESSHNFESMSPAKPVQHHRERKRASKSSKHSMS. | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Human | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| cystine-knot containing secreted protein, DKFZp564D206, Ectodermal BMP inhibitor, ECTODIN, sclerostin domain containing 1, sclerostin domain-containing protein 1, USAG-1, USAG1uterine sensitization-associated protein-1, Uterine sensitization-associated gene 1 protein | |
| Rabbit | |
| 21 kDa | |
| 20 μL | |
| Signal Transduction | |
| 25928 | |
| Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction