Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Plakophilin 4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | Plakophilin 4 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Plakophilin 4 Polyclonal specifically detects Plakophilin 4 in Human samples. It is validated for Western Blot.Specifications
Plakophilin 4 | |
Polyclonal | |
Rabbit | |
NP_001005476 | |
8502 | |
The immunogen for this antibody is plakophilin 4 - N-terminal region. Peptide sequence MPAPEQASLVEEGQPQTRQEAASTGPGMEPETTATTILASVKEQELQFQR. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
catenin 4, FLJ42243, p0071FLJ31261, plakophilin 4, plakophilin-4 | |
PKP4 | |
IgG | |
127 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title