Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Doc2-alpha Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$492.89
Specifications
| Antigen | Doc2-alpha |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
Doc2-alpha Polyclonal specifically detects Doc2-alpha in Human samples. It is validated for Western Blot.Specifications
| Doc2-alpha | |
| Polyclonal | |
| Rabbit | |
| NP_003577 | |
| 8448 | |
| The immunogen for this antibody is DOC2A - N-terminal region. Peptide sequence HCSILRAKGLKPMDFNGLADPYVKLHLLPGACKANKLKTKTQRNTLNPVW. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Doc2, doc2-alpha, double C2-like domain-containing protein alpha, double C2-like domains, alpha | |
| DOC2A | |
| IgG | |
| 44 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title