FKBP10 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP198561

Catalog No. NBP198561

Description

FKBP10 Polyclonal specifically detects FKBP10 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: FKBP10
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: 65 kDa FK506-binding protein, 65 kDa FKBP, EC 5.2.1.8, FK506 binding protein 10 (65 kDa), FK506 binding protein 10, 65 kDa, FK506-binding protein 10, FKBP-10, FKBP6, FKBP-65, FKBP65PPIase FKBP10, FLJ20683, FLJ22041, FLJ23833, hFKBP65, Immunophilin FKBP65, OI6, peptidyl-prolyl cis-trans isomerase FKBP10, PPIASE, Rotamase
• Host Species: Rabbit
• Molecular Weight of Antigen: 61 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Zebrafish: 86%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Yeast, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_068758
• Gene Symbols: FKBP10
• Immunogen: The immunogen for this antibody is FKBP10 - N-terminal region. Peptide sequence VRYHYNGTFEDGKKFDSSYDRNTLVAIVVGVGRLITGMDRGLMGMCVNER.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 60681
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.