Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NADK Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP19856220UL
Description
NADK Polyclonal specifically detects NADK in Human samples. It is validated for Western Blot.Specifications
NADK | |
Polyclonal | |
Western Blot 1:1000 | |
NP_001185924 | |
NADK | |
The immunogen for this antibody is NADK - C-terminal region. Peptide sequence ARNTAWVSFDGRKRQEIRHGDSISITTSCYPLPSICVRDPVSDWFESLAQ. | |
Affinity Purified | |
RUO | |
65220 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
dJ283E3.1, DKFZp686L22239, EC 2.7.1, EC 2.7.1.23, FLJ13052, FLJ37724, FLJ54695, FLJ77769, FLJ78247, FLJ78307, MGC1900, NAD kinase, Poly(P)/ATP NAD kinase | |
Rabbit | |
45 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction