Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NADK Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$158.00 - $487.50
Specifications
| Antigen | NADK |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP19856220
|
Novus Biologicals
NBP19856220UL |
20 μL |
Each for $158.00
|
|
|||||
|
NBP198562
|
Novus Biologicals
NBP198562 |
100 μL |
Each for $487.50
|
|
|||||
Description
NADK Polyclonal specifically detects NADK in Human samples. It is validated for Western Blot.Specifications
| NADK | |
| Polyclonal | |
| Rabbit | |
| NP_001185924 | |
| 65220 | |
| The immunogen for this antibody is NADK - C-terminal region. Peptide sequence ARNTAWVSFDGRKRQEIRHGDSISITTSCYPLPSICVRDPVSDWFESLAQ. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| dJ283E3.1, DKFZp686L22239, EC 2.7.1, EC 2.7.1.23, FLJ13052, FLJ37724, FLJ54695, FLJ77769, FLJ78247, FLJ78307, MGC1900, NAD kinase, Poly(P)/ATP NAD kinase | |
| NADK | |
| IgG | |
| 45 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title