Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
OBP2A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | OBP2A |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
OBP2A Polyclonal specifically detects OBP2A in Human samples. It is validated for Western Blot.Specifications
OBP2A | |
Polyclonal | |
Rabbit | |
NP_055397 | |
29991 | |
The immunogen for this antibody is OBP2A - middle region. Peptide sequence NLEATFTFMREDRCIQKKILMRKTEEPGKFSAYGGRKLIYLQELPGTDDY. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
hOBPIIa, OBP, OBP2C, OBPIIa, odorant binding protein 2A, odorant-binding protein 2a, Odorant-binding protein IIa, putative odorant-binding protein 2c | |
OBP2A | |
IgG | |
18 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title