Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
IMPG1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | IMPG1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
IMPG1 Polyclonal specifically detects IMPG1 in Human samples. It is validated for Western Blot.Specifications
IMPG1 | |
Polyclonal | |
Rabbit | |
Human | |
GP147, interphotoreceptor matrix proteoglycan 1, IPM150, SPACR | |
IMPG1 | |
IgG | |
89 kDa |
Western Blot | |
Unconjugated | |
RUO | |
NP_001554 | |
3617 | |
The immunogen for this antibody is IMPG1 - C-terminal region. Peptide sequence TKECEVLQGKGAPCRLPDHSENQAYKTSVKKFQNQQNNKVISKRNSELLT. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title