Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Cathepsin W Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$499.50
Specifications
Antigen | Cathepsin W |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Cathepsin W Polyclonal specifically detects Cathepsin W in Human samples. It is validated for Western Blot.Specifications
Cathepsin W | |
Polyclonal | |
Rabbit | |
Human | |
cathepsin W, cathepsin W (lymphopain), EC 3.4.22.-, Lymphopain, LYPN | |
CTSW | |
IgG | |
28 kDa |
Western Blot | |
Unconjugated | |
RUO | |
NP_001326 | |
1521 | |
The immunogen for this antibody is Cathepsin W - N-terminal region. Peptide sequence TEEEFGQLYGYRRAAGGVPSMGREIRSEEPEESVPFSCDWRKVAGAISPI. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title