EI24 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP198605

Catalog No. NBP198605

Description

EI24 Polyclonal specifically detects EI24 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: EI24
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EPG4, etoposide induced 2.4 mRNA, p53-induced gene 8 protein, PIG8etoposide-induced protein 2.4 homolog, TP53I8, tumor protein p53 inducible protein 8
• Host Species: Rabbit
• Molecular Weight of Antigen: 30 kDa
• Quantity: 100 μL
• Research Discipline: Apoptosis
• Gene ID (Entrez): 9538
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_001007278
• Gene Symbols: EI24
• Immunogen: The immunogen for this antibody is EI24 - N-terminal region. Peptide sequence ICTISKLDARIQQKREEQRRRRASSVLAQRRAQSIERKQESEPRIVSRIF.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Yeast: 77%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Yeast, Zebrafish
• Isotype: IgG