Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
EI24 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$480.74
Specifications
| Antigen | EI24 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
EI24 Polyclonal specifically detects EI24 in Human samples. It is validated for Western Blot.Specifications
| EI24 | |
| Polyclonal | |
| Rabbit | |
| Apoptosis | |
| EPG4, etoposide induced 2.4 mRNA, p53-induced gene 8 protein, PIG8etoposide-induced protein 2.4 homolog, TP53I8, tumor protein p53 inducible protein 8 | |
| EI24 | |
| IgG | |
| 30 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_001007278 | |
| 9538 | |
| The immunogen for this antibody is EI24 - N-terminal region. Peptide sequence ICTISKLDARIQQKREEQRRRRASSVLAQRRAQSIERKQESEPRIVSRIF. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title