Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Activin C/Inhibin beta C Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | Activin C/Inhibin beta C |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP198297
|
Novus Biologicals
NBP198297 |
100 μL |
Each for $487.50
|
|
|||||
|
NBP19829720
|
Novus Biologicals
NBP19829720UL |
20 μL | N/A | N/A | N/A | ||||
Description
Activin C/Inhibin beta C Polyclonal specifically detects Activin C/Inhibin beta C in Human samples. It is validated for Western Blot.Specifications
| Activin C/Inhibin beta C | |
| Polyclonal | |
| Rabbit | |
| NP_005529 | |
| 3626 | |
| The immunogen for this antibody is INHBC - N-terminal region. Peptide sequence QECEIISFAETGLSTINQTRLDFHFSSDRTAGDREVQQASLMFFVQLPSN. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| inhibin beta C chain, IHBC, inhibin, beta C | |
| INHBC | |
| IgG | |
| 13 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title