Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ESAM Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | ESAM |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
ESAM Polyclonal specifically detects ESAM in Human samples. It is validated for Western Blot.Specifications
ESAM | |
Polyclonal | |
Rabbit | |
Human | |
2310008D05Rik, endothelial cell adhesion molecule, endothelial cell-selective adhesion molecule, HUEL (C4orf1)-interacting protein, LP4791 protein, W117m | |
ESAM | |
IgG | |
41 kDa |
Western Blot | |
Unconjugated | |
RUO | |
NP_620411 | |
90952 | |
The immunogen for this antibody is ESAM - N-terminal region. Peptide sequence VTNLLRFLFLGLSALAPPSRAQLQLHLPANRLQAVEGGEVVLPAWYTLHG. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title