Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. CNOT8 Antibody, Novus Biologicals™

CNOT8 Antibody, Novus Biologicals™
SDP

Catalog No. NBP198338 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP198338 100 μL
NBP19833820 20 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP198338 Supplier Novus Biologicals Supplier No. NBP198338
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

CNOT8 Polyclonal specifically detects CNOT8 in Mouse samples. It is validated for Western Blot.

Specifications

Antigen CNOT8
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. NP_081225
Gene Alias CAF1, CAF2, CALIFCAF1-like protein, CALIFp, CCR4-NOT transcription complex subunit 8, CCR4-NOT transcription complex, subunit 8, hCAF1, PGK promoter directed over production, POP2CCR4-associated factor 8
Gene Symbols CNOT8
Host Species Rabbit
Immunogen The immunogen for this antibody is Cnot8 - N-terminal region. Peptide sequence VWASNLEEEMRKIREIVLSYSYIAMDTEFPGVVVRPIGEFRSSIDYQYQL.
Molecular Weight of Antigen 33 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline DNA replication Transcription Translation and Splicing
Primary or Secondary Primary
Gene ID (Entrez) 9337
Test Specificity Zebrafish: 86%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.