CP2F2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP198269

Catalog No. NBP198269

Description

CP2F2 Polyclonal specifically detects CP2F2 in Rat samples. It is validated for Western Blot.

Specifications

• Antigen: CP2F2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Cyp2f2
• Host Species: Rabbit
• Molecular Weight of Antigen: 54 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_062176
• Gene Symbols: Cyp2f2
• Immunogen: The immunogen for this antibody is CP2F2 - middle region. Peptide sequence EHQDSLDPNSPRDFIDCFLTKMVQEKQDPLSHFNMDTLLMTTHNLLFGGT.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Test Specificity: Porcine: 86%; Goat: 86%; Equine: 86%; Mouse: 86%; Bovine: 86%; Canine: 77%.
• Target Species: Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Goat, Rabbit
• Isotype: IgG