Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
V alpha 24 J alpha 18 TCR Antibody (6B11) - BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP19826920UL
Description
CP2F2 Polyclonal specifically detects CP2F2 in Rat samples. It is validated for Western Blot.Specifications
CP2F2 | |
Polyclonal | |
Western Blot 1:1000 | |
NP_062176 | |
Rabbit | |
54 kDa | |
20 μL | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
Cyp2f2 | |
The immunogen for this antibody is CP2F2 - middle region. Peptide sequence EHQDSLDPNSPRDFIDCFLTKMVQEKQDPLSHFNMDTLLMTTHNLLFGGT. | |
Affinity Purified | |
RUO | |
Rat | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title