Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PITPN Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$480.74
Specifications
| Antigen | PITPN |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
PITPN Polyclonal specifically detects PITPN in Mouse samples. It is validated for Western Blot.Specifications
| PITPN | |
| Polyclonal | |
| Rabbit | |
| NP_032876 | |
| 5306 | |
| The immunogen for this antibody is PITPN - C-terminal region. Peptide sequence FTNFHRQLFCWLDKWVDLTMDDIRRMEEETKRQLDEMRQKDPVKGMTADD. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| MGC99649, phosphatidylinositol transfer protein alpha isoform, phosphatidylinositol transfer protein, alpha, PI-TPalpha, PI-TP-alpha, PITPNphosphotidylinositol transfer protein, PtdIns transfer protein alpha, PtdInsTP alpha, VIB1A | |
| PITPNA | |
| IgG | |
| 32 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title