Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PITPN Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | PITPN |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
PITPN Polyclonal specifically detects PITPN in Mouse samples. It is validated for Western Blot.Specifications
PITPN | |
Polyclonal | |
Rabbit | |
NP_032876 | |
5306 | |
The immunogen for this antibody is PITPN - C-terminal region. Peptide sequence FTNFHRQLFCWLDKWVDLTMDDIRRMEEETKRQLDEMRQKDPVKGMTADD. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
MGC99649, phosphatidylinositol transfer protein alpha isoform, phosphatidylinositol transfer protein, alpha, PI-TPalpha, PI-TP-alpha, PITPNphosphotidylinositol transfer protein, PtdIns transfer protein alpha, PtdInsTP alpha, VIB1A | |
PITPNA | |
IgG | |
32 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title