Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
BCO2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | BCO2 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
BCO2 Polyclonal specifically detects BCO2 in Mouse samples. It is validated for Western Blot.Specifications
BCO2 | |
Polyclonal | |
Rabbit | |
NP_573480 | |
83875 | |
The immunogen for this antibody is Bco2 - middle region. Peptide sequence CYNIIRVPPKKKEPGETIHGAQVLCSIASTEKMKPSYYHSFGMTKNYIIF. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
beta-carotene oxygenase 2 | |
BCO2 | |
IgG | |
60 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title