Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
APH1B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP19841420UL
Description
APH1B Polyclonal specifically detects APH1B in Human, Mouse samples. It is validated for Western Blot.Specifications
APH1B | |
Polyclonal | |
Western Blot 1:1000 | |
NP_001139118 | |
APH1B | |
The immunogen for this antibody is Gamma-secretase subunit APH-1B - C-terminal region. Peptide sequence YYGINLASAFIILVLMGTWAFLAAGGSCRSLKLCLLCQDKNFLLYNQRSR. | |
Affinity Purified | |
RUO | |
83464 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
anterior pharynx defective 1 homolog B (C. elegans) | |
Rabbit | |
23 kDa | |
20 μL | |
Primary | |
Human, Mouse | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction