Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CD84/SLAMF5 Antibody, Novus Biologicals™
SDP

Catalog No. p-7110520 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP198409 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP198409 Supplier Novus Biologicals Supplier No. NBP198409
Only null left
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

CD84/SLAMF5 Polyclonal specifically detects CD84/SLAMF5 in Human samples. It is validated for Western Blot.

Specifications

Antigen CD84/SLAMF5
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. NP_003865
Gene Alias CD84 antigen, CD84 antigen (leukocyte antigen), CD84 molecule, Cell surface antigen MAX.3, DKFZp781E2378, hCD84, hly9-beta, leucocyte differentiation antigen CD84, leukocyte antigen CD84, Leukocyte differentiation antigen CD84, mCD84, Signaling lymphocytic activation molecule 5, SLAM family member 5, SLAMF5LY9B
Gene Symbols CD84
Host Species Rabbit
Immunogen The immunogen for this antibody is CD84 - C-terminal region. Peptide sequence: YDEILQSKVLPSKEEPVNTVYSEVQFADKMGKASTQDSKPPGTSSYEIVI
Molecular Weight of Antigen 34 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 8832
Test Specificity Expected identity based on immunogen sequence: Pig: 92%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Pig
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.