Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

APH1B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$206.00 - $487.50

Specifications

Antigen	APH1B
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP19841420 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP19841420UL	20 μL	Each for $206.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP198414 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP198414	100 μL	Each for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

APH1B Polyclonal specifically detects APH1B in Human, Mouse samples. It is validated for Western Blot.

Specifications

Antigen	APH1B
Classification	Polyclonal
Host Species	Rabbit
Gene Accession No.	NP_001139118
Gene ID (Entrez)	83464
Immunogen	The immunogen for this antibody is Gamma-secretase subunit APH-1B - C-terminal region. Peptide sequence YYGINLASAFIILVLMGTWAFLAAGGSCRSLKLCLLCQDKNFLLYNQRSR.
Primary or Secondary	Primary

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Alias	anterior pharynx defective 1 homolog B (C. elegans)
Gene Symbols	APH1B
Isotype	IgG
Molecular Weight of Antigen	23 kDa

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

APH1B Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents