Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
APH1B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | APH1B |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP19841420
|
Novus Biologicals
NBP19841420UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP198414
|
Novus Biologicals
NBP198414 |
100 μL |
Each for $487.50
|
|
|||||
Description
APH1B Polyclonal specifically detects APH1B in Human, Mouse samples. It is validated for Western Blot.Specifications
| APH1B | |
| Polyclonal | |
| Rabbit | |
| NP_001139118 | |
| 83464 | |
| The immunogen for this antibody is Gamma-secretase subunit APH-1B - C-terminal region. Peptide sequence YYGINLASAFIILVLMGTWAFLAAGGSCRSLKLCLLCQDKNFLLYNQRSR. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| anterior pharynx defective 1 homolog B (C. elegans) | |
| APH1B | |
| IgG | |
| 23 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title