Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
4930567H17Rik Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | 4930567H17Rik |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
4930567H17Rik Polyclonal specifically detects 4930567H17Rik in Mouse samples. It is validated for Western Blot.Specifications
4930567H17Rik | |
Polyclonal | |
Rabbit | |
NP_001028979 | |
619303 | |
The immunogen for this antibody is 4930567H17Rik. Peptide sequence TLSSYDPCRYILKAALSVITAWENTLEEEEEDEEEDEEEEEMEEEDEGEE. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
4930567H17Rik RIKEN cDNA 4930567H17 gene | |
4930567H17RIK | |
IgG | |
27 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title