Invitrogen™ VAChT Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA595404

Catalog No. PIPA595404

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: HELA whole cell, HEPA whole cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

This gene is a member of the vesicular amine transporter family. The encoded transmembrane protein transports acetylcholine into secretory vesicles for release into the extracellular space. Acetylcholine transport utilizes a proton gradient established by a vacuolar ATPase. This gene is located within the first intron of the choline acetyltransferase gene.

Specifications

• Antigen: VAChT
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: SLC18A3
• Gene Alias: MGC12716; rVAT; SLC18A3; solute carrier family 18 (vesicular acetylcholine transporter), member 3; solute carrier family 18 (vesicular acetylcholine), member 3; solute carrier family 18 (vesicular monoamine) member 3; solute carrier family 18 (vesicular monoamine), member 3; solute carrier family 18 member 3; solute carrier family 18 member A3; solute carrier family 18, member 3; VAChT; VAT; vesicular acetylcholine transporter
• Host Species: Rabbit
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 20508, 6572
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 5mg BSA and 0.05mg sodium azide
• Gene Accession No.: O35304, Q16572
• Gene Symbols: SLC18A3
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human SLC18A3 (1-36aa MESAEPAGQARAAATKLSEAVGAALQEPRRQRRLVL).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse
• Product Type: Antibody
• Isotype: IgG

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov