Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIPA595404

Invitrogen™ VAChT Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA595404
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA595404 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA595404 Supplier Invitrogen™ Supplier No. PA595404
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: HELA whole cell, HEPA whole cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

This gene is a member of the vesicular amine transporter family. The encoded transmembrane protein transports acetylcholine into secretory vesicles for release into the extracellular space. Acetylcholine transport utilizes a proton gradient established by a vacuolar ATPase. This gene is located within the first intron of the choline acetyltransferase gene.
TRUSTED_SUSTAINABILITY

Specifications

Antigen VAChT
Applications Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 5mg BSA and 0.05mg sodium azide
Gene SLC18A3
Gene Accession No. O35304, Q16572
Gene Alias MGC12716; rVAT; SLC18A3; solute carrier family 18 (vesicular acetylcholine transporter), member 3; solute carrier family 18 (vesicular acetylcholine), member 3; solute carrier family 18 (vesicular monoamine) member 3; solute carrier family 18 (vesicular monoamine), member 3; solute carrier family 18 member 3; solute carrier family 18 member A3; solute carrier family 18, member 3; VAChT; VAT; vesicular acetylcholine transporter
Gene Symbols SLC18A3
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human SLC18A3 (1-36aa MESAEPAGQARAAATKLSEAVGAALQEPRRQRRLVL).
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 20508, 6572
Target Species Human, Mouse
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.