VE-Cadherin Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP321223

Catalog No. NB362533

Description

VE-Cadherin Polyclonal antibody specifically detects VE-Cadherin in Human samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence

Specifications

• Antigen: VE-Cadherin
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 ug/mL, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL
• Gene Alias: 7B4, 7B4 antigen, cadherin 5, type 2 (vascular endothelium), cadherin 5, type 2, VE-cadherin (vascular epithelium), cadherin-5, CD144, CD144 antigen, endothelial-specific cadherin, FLJ17376, Vascular endothelial cadherin, VE-cadherin
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SLPHHVGKIKSSVSRKNAKYLLKGEYVGKVFRVDAETGDVFAIERLDRENISEYHLTAVIVDKDTGENLETP
• Quantity: 100 μL
• Research Discipline: Cancer, Cell Cycle and Replication, Cellular Markers, Extracellular Matrix, Phospho Specific, Plasma Membrane Markers, Signal Transduction
• Gene ID (Entrez): 1003
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunocytochemistry
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified