Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

VE-Cadherin Antibody, Novus Biologicals™
SDP

Catalog No. NB362533 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB362533 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB362533 Supplier Novus Biologicals Supplier No. NBP321223
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

VE-Cadherin Polyclonal antibody specifically detects VE-Cadherin in Human samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence

Specifications

Antigen VE-Cadherin
Applications Western Blot, Immunocytochemistry
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 ug/mL, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias 7B4, 7B4 antigen, cadherin 5, type 2 (vascular endothelium), cadherin 5, type 2, VE-cadherin (vascular epithelium), cadherin-5, CD144, CD144 antigen, endothelial-specific cadherin, FLJ17376, Vascular endothelial cadherin, VE-cadherin
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: SLPHHVGKIKSSVSRKNAKYLLKGEYVGKVFRVDAETGDVFAIERLDRENISEYHLTAVIVDKDTGENLETP
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Cancer, Cell Cycle and Replication, Cellular Markers, Extracellular Matrix, Phospho Specific, Plasma Membrane Markers, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 1003
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.