Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
VEGFR2/KDR/Flk-1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP325223
Description
VEGFR2/KDR/Flk-1 Polyclonal antibody specifically detects VEGFR2/KDR/Flk-1 in Human samples. It is validated for Immunocytochemistry/ ImmunofluorescenceSpecifications
VEGFR2/KDR/Flk-1 | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL | |
CD309, CD309 antigen, EC 2.7.10, EC 2.7.10.1, Fetal liver kinase 1, fetal liver kinase-1, FLK-1, FLK1tyrosine kinase growth factor receptor, Kinase insert domain receptor, kinase insert domain receptor (a type III receptor tyrosine kinase), Protein-tyrosine kinase receptor flk-1, soluble VEGFR2, vascular endothelial growth factor receptor 2, VEGFR, VEGFR2, VEGFR-2 | |
This antibody has been engineered to specifically recognize the recombinant protein VEGFR2/KDR/Flk-1 using the following amino acid sequence: TARTELNVGIDFNWEYPSSKHQHKKLVNRDLKTQSGSEMKKFLSTLTIDGVTRSDQGLYTCAASSGLMTKKNSTFVRVHEKPFVAFGSGMESLVEA | |
100 μL | |
Angiogenesis, Apoptosis, Cancer, Cell Biology, Cellular Markers, Endothelial Cell Markers, Hematopoietic Stem Cell Markers, HIF Target Genes, Hypoxia, Phospho Specific, Signal Transduction, Stem Cell Markers, Tumor Suppressors, Tyrosine Kinases | |
3791 | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
IgG |
Immunocytochemistry | |
Unconjugated | |
PBS, pH 7.2, 40% glycerol | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction