VEGFR3/Flt-4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP321370100UL

Catalog No. NB239983

Description

VEGFR3/Flt-4 Polyclonal antibody specifically detects VEGFR3/Flt-4 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: VEGFR3/Flt-4
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Alias: EC 2.7.10, EC 2.7.10.1, FLT-4, fms-related tyrosine kinase 4, LMPH1A, PCLFLT41, soluble VEGFR3 variant 1, soluble VEGFR3 variant 2, soluble VEGFR3 variant 3, Tyrosine-protein kinase receptor FLT4, vascular endothelial growth factor receptor 3, VEGFR-3, VEGFR3Fms-like tyrosine kinase 4
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: YKCVVSNKVGQDERLIYFYVTTIPDGFTIESKPSEELLEGQPVLLSCQADSYKYEHLRWYRLNLSTLHDAHGNPLLLDCK
• Quantity: 100 μg
• Research Discipline: Angiogenesis, Cancer, Hypoxia, Protein Kinase
• Gene ID (Entrez): 2324
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified