Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
VEGFR3/Flt-4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP321370100UL
Description
VEGFR3/Flt-4 Polyclonal antibody specifically detects VEGFR3/Flt-4 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
VEGFR3/Flt-4 | |
Polyclonal | |
Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
EC 2.7.10, EC 2.7.10.1, FLT-4, fms-related tyrosine kinase 4, LMPH1A, PCLFLT41, soluble VEGFR3 variant 1, soluble VEGFR3 variant 2, soluble VEGFR3 variant 3, Tyrosine-protein kinase receptor FLT4, vascular endothelial growth factor receptor 3, VEGFR-3, VEGFR3Fms-like tyrosine kinase 4 | |
This antibody was developed against Recombinant Protein corresponding to amino acids: YKCVVSNKVGQDERLIYFYVTTIPDGFTIESKPSEELLEGQPVLLSCQADSYKYEHLRWYRLNLSTLHDAHGNPLLLDCK | |
100 μg | |
Angiogenesis, Cancer, Hypoxia, Protein Kinase | |
2324 | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
IgG |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS, pH 7.2, 40% glycerol | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction