Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
VGCNL1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP190028
Description
VGCNL1 Polyclonal specifically detects VGCNL1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
VGCNL1 | |
Polyclonal | |
Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
bA430M15.1, CanIonFLJ44659, FLJ23913, FLJ44764, four repeat voltage-gated ion channel, MGC74524, sodium leak channel non-selective protein, sodium leak channel, non-selective, VGCNL1, voltage gated channel like 1, Voltage gated channel-like protein 1 | |
Rabbit | |
Affinity Purified | |
RUO | |
259232 | |
Human | |
IgG |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
NALCN | |
This antibody was developed against Recombinant Protein corresponding to amino acids:TYHCVVNDTKPGNVTWNSLAIPDTHCSPELEEGYQCPPGFKCMDLEDLGLSRQELGYSGFNE | |
0.1 mL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction