Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
VGLL1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP309366100UL
Description
VGLL1 Polyclonal specifically detects VGLL1 in Human samples. It is validated for Western Blot.Specifications
VGLL1 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
Protein TONDU, TDUtranscription cofactor vestigial-like protein 1, TONDU, vestigial like 1 (Drosophila), Vgl-1, VGL1, WUGSC:H_GS188P18.1b | |
The immunogen is a synthetic peptide directed towards the middle region of human VGLL1 (NP_057351). Peptide sequence RPQESAARENGNPGQIAGSTGLLFNLPPGSVHYKKLYVSRGSASTSLPNE | |
100 μg | |
Primary | |
Human | |
Purified |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
51442 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction