VIAAT/SLC32A1/VGAT Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP23411725UL

Catalog No. NB436630

Description

VIAAT/SLC32A1/VGAT Polyclonal specifically detects VIAAT/SLC32A1/VGAT in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: VIAAT/SLC32A1/VGAT
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Accession No.: Q9H598
• Gene Symbols: SLC32A1
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: ATSVSNKSQAKMSGMFARMGFQAATDEEAVGFAHCDDLDFEHRQGLQMDILKAEGEPCGDEGAEAPVEGDIHYQRGSGAPLPPSGSKDQVG
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: bA122O1.1, hVIAAT, solute carrier family 32 (GABA vesicular transporter), member 1, Solute carrier family 32 member 1, Vesicular GABA transporter, vesicular inhibitory amino acid transporter, VGATGABA and glycine transporter, VIAAT
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 140679
• Target Species: Human
• Isotype: IgG

For Research Use Only