Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. VIAAT/SLC32A1/VGAT Antibody, Novus Biologicals™

VIAAT/SLC32A1/VGAT Antibody, Novus Biologicals™
SDP

Catalog No. p-200045256 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB436630 25 μL
NBP234117 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB436630 Supplier Novus Biologicals Supplier No. NBP23411725UL
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

VIAAT/SLC32A1/VGAT Polyclonal specifically detects VIAAT/SLC32A1/VGAT in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen VIAAT/SLC32A1/VGAT
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. Q9H598
Gene Alias bA122O1.1, hVIAAT, solute carrier family 32 (GABA vesicular transporter), member 1, Solute carrier family 32 member 1, Vesicular GABA transporter, vesicular inhibitory amino acid transporter, VGATGABA and glycine transporter, VIAAT
Gene Symbols SLC32A1
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: ATSVSNKSQAKMSGMFARMGFQAATDEEAVGFAHCDDLDFEHRQGLQMDILKAEGEPCGDEGAEAPVEGDIHYQRGSGAPLPPSGSKDQVG
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 140679
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.