VIPR2/VPAC2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP23414925UL

Catalog No. NB436618

Description

VIPR2/VPAC2 Polyclonal specifically detects VIPR2/VPAC2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: VIPR2/VPAC2
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Accession No.: P41587
• Gene Symbols: VIPR2
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: NSIHPECRFHLEIQEEETKCAELLRSQTEKHKACSGVWDNITCWR
• Quantity: 25 μL
• Research Discipline: Cancer, GPCR, Neuroscience, Neurotransmission, Signal Transduction
• Gene ID (Entrez): 7434
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: FLJ16511, Helodermin-preferring VIP receptor, PACAP type III receptor, PACAP-R3, PACAP-R-3, Pituitary adenylate cyclase-activating polypeptide type III receptor, vasoactive intestinal peptide receptor 2, vasoactive intestinal polypeptide receptor 2, VIP2R, VIP-R-2, VPAC2, VPCAP2R
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only