Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
VISTA/B7-H5/PD-1H Antibody (CL3975), Novus Biologicals™

Mouse Monoclonal Antibody
$382.00 - $646.00
Specifications
Antigen | VISTA/B7-H5/PD-1H |
---|---|
Dilution | Western Blot 1:500 - 1:1000, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 |
Classification | Monoclonal |
Conjugate | Unconjugated |
Form | Purified |
Description
VISTA/B7-H5/PD-1H Monoclonal specifically detects VISTA/B7-H5/PD-1H in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
VISTA/B7-H5/PD-1H | |
Monoclonal | |
Purified | |
RUO | |
Human | |
64115 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYPSSS | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Western Blot 1:500 - 1:1000, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
Unconjugated | |
Mouse | |
Cancer, Cardiovascular Biology, Immunology | |
B7H5, B7-H5, C10orf54, chromosome 10 open reading frame 54, GI24, platelet receptor Gi24, PP2135, SISP1, stress induced secreted protein 1, VSIR | |
C10ORF54 | |
IgG1 | |
Protein A purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title