Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
VNN3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$464.00
Specifications
Antigen | VNN3 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
VNN3 Polyclonal specifically detects VNN3 in Human samples. It is validated for Western Blot.Specifications
VNN3 | |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
HSA238982, MGC171203, vanin 3 | |
VNN3 | |
IgG | |
Affinity Purified | |
28 kDa |
Western Blot | |
Unconjugated | |
RUO | |
Q9NY84-2 | |
55350 | |
Synthetic peptides corresponding to VNN3(vanin 3) Antibody(against the N terminal of VNN3. Peptide sequence VILPNRTETPVSKEEALLLMNKNIDVLEKAVKLAAKQGAHIIVTPEDGIY. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title