Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Vomeronasal 1 receptor 54 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | Vomeronasal 1 receptor 54 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
Vomeronasal 1 receptor 54 Polyclonal specifically detects Vomeronasal 1 receptor 54 in Mouse samples. It is validated for Western Blot.Specifications
| Vomeronasal 1 receptor 54 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Mouse | |
| V1, V1ra9, VN7 | |
| The immunogen is a synthetic peptide directed towards the N terminal region of mouse Vomeronasal 1 receptor 54 (NP_444454.1). Peptide sequence NKMNRLSHNTEIRNAIYSGVGIGISGNSFLLLFHIFKYIRGQRSRHIDLP | |
| Affinity purified |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 113851 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title