VprBP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP257102

Catalog No. NBP257102

Description

VprBP Polyclonal specifically detects VprBP in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: VprBP
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: DCAF1DDB1 and CUL4 associated factor 1, DDB1- and CUL4-associated factor 1, HIV-1 Vpr-binding protein, KIAA0800protein VPRBP, MGC102804, RIP, Vpr (HIV-1) binding protein, Vpr-binding protein, VprBP, Vpr-interacting protein
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 9730
• Target Species: Human
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: VPRBP
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SAKQGDRENFRKAKQKLGFSSSDPDRMFVELSNSSWSEMSPWVIGTNYTLYPMTPAIEQRLILQYLTPLGEYQELLPIFMQLGSRELMMFYIDLKQTNDVLL
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only