VPS25 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP325226

Catalog No. NB301226

Description

VPS25 Polyclonal antibody specifically detects VPS25 in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence

Specifications

• Antigen: VPS25
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
• Gene Alias: Dermal papilla-derived protein 9, DERP9, DERP9hVps25, EAP20, EAP20FAP20, ELL-associated protein of 20 kDa, ESCRT-II complex subunit VPS25, FAP20, MGC10540, vacuolar protein sorting 25 (yeast), vacuolar protein sorting 25 homolog (S. cerevisiae), vacuolar protein-sorting-associated protein 25
• Immunogen: This antibody has been engineered to specifically recognize the recombinant protein VPS25 using the following amino acid sequence: WLDKSKSSFLIMWRRPEEWGKLIYQWVSRSGQNNSVFTLYELTNGEDTEDEEFHGLDEATLLRALQALQQEHKAEIITVSD
• Quantity: 100 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 84313
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunocytochemistry
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified