Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. VPS36 Antibody, Novus Biologicals™

VPS36 Antibody, Novus Biologicals™
SDP

Catalog No. NB438476 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mL
25ul
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB438476 25ul
NBP213518 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB438476 Supplier Novus Biologicals Supplier No. NBP21351825UL
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

VPS36 Polyclonal specifically detects VPS36 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen VPS36
Applications Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias C13orf9, CGI-145, DKFZp781E0871, Eap45, EAP45chromosome 13 open reading frame 9, ELL-associated protein of 45 kDa, ELL-associated protein, 45 kDa, ESCRT-II complex subunit VPS36, vacuolar protein sorting 36 homolog (S. cerevisiae), vacuolar protein sorting 36 homolog (yeast), vacuolar protein-sorting-associated protein 36
Gene Symbols VPS36
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the amino acids: AGIGKSAKIVVHLHPAPPNKEPGPFQSSKNSYIKLSFKEHGQIEFYRRLSEEMTQRRWENMPVSQSLQTNRG
Purification Method Affinity Purified
Quantity 25ul
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 51028
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.