VPS4A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP154618

Catalog No. NBP154618

Description

VPS4A Polyclonal specifically detects VPS4A in Human samples. It is validated for Western Blot.

Specifications

• Antigen: VPS4A
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: FLJ22197, hVPS4, Protein SKD2, SKD1, SKD1A, SKD2, vacuolar protein sorting 4 homolog A (S. cerevisiae), vacuolar protein sorting 4A (yeast homolog), vacuolar protein sorting factor 4A, vacuolar protein sorting-associated protein 4A, vacuolar sorting protein 4, VPS4-1SKD1-homolog, VPS4vacuolar protein sorting 4A (yeast)
• Host Species: Rabbit
• Molecular Weight of Antigen: 49 kDa
• Quantity: 100 μL
• Research Discipline: Protein Phosphatase
• Gene ID (Entrez): 27183
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry
• Gene Accession No.: Q9UN37
• Gene Symbols: VPS4A
• Immunogen: Synthetic peptides corresponding to VPS4A(vacuolar protein sorting 4 homolog A (S. cerevisiae)) The peptide sequence was selected from the N terminal of VPS4A. Peptide sequence YFLHAIKYEAHSDKAKESIRAKCVQYLDRAEKLKDYLRSKEKHGKKPVKE.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only