Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

VPS4A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$499.50

Specifications

Antigen	VPS4A
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 1

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP155140 View Documents View Product Certificates	Novus Biologicals NBP155140	100 μL	Each of 1 for $499.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

VPS4A Polyclonal specifically detects VPS4A in Human samples. It is validated for Western Blot.

Specifications

Antigen	VPS4A
Classification	Polyclonal
Host Species	Rabbit
Research Discipline	Protein Phosphatase
Gene Alias	FLJ22197, hVPS4, Protein SKD2, SKD1, SKD1A, SKD2, vacuolar protein sorting 4 homolog A (S. cerevisiae), vacuolar protein sorting 4A (yeast homolog), vacuolar protein sorting factor 4A, vacuolar protein sorting-associated protein 4A, vacuolar sorting protein 4, VPS4-1SKD1-homolog, VPS4vacuolar protein sorting 4A (yeast)
Gene Symbols	VPS4A
Isotype	IgG
Molecular Weight of Antigen	49 kDa

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Accession No.	Q9UN37
Gene ID (Entrez)	27183
Immunogen	Synthetic peptides corresponding to VPS4A(vacuolar protein sorting 4 homolog A (S. cerevisiae)) The peptide sequence was selected from the N terminal of VPS4A. Peptide sequence LRSKEKHGKKPVKENQSEGKGSDSDSEGDNPEKKKLQEQLMGAVVMEKPN.
Primary or Secondary	Primary

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

VPS4A Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents