Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
VPS54 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | VPS54 |
---|---|
Applications | Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
VPS54 Polyclonal specifically detects VPS54 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
VPS54 | |
Polyclonal | |
Rabbit | |
Human | |
51542 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EKIHERCKNICPPKDTFERTLLHTHDKSRTDLEQVPKIFMKPDFALDDSLTFNSVLPWSHFNTAGGKGNRDAASSKLLQEKLSHYLDIVEVN | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
HCC8SLP-8p, Hepatocellular carcinoma protein 8, hVps54L, Tumor antigen HOM-HCC-8, Tumor antigen SLP-8p, vacuolar protein sorting 54 (yeast), vacuolar protein sorting 54 homolog (S. cerevisiae), vacuolar protein sorting-associated protein 54, VPS54L | |
VPS54 | |
IgG | |
Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title