VPS8 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP155274

Catalog No. NBP155274

Description

VPS8 Polyclonal specifically detects VPS8 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: VPS8
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: KIAA0804FLJ32099, vacuolar protein sorting 8 homolog (S. cerevisiae), vacuolar protein sorting-associated protein 8 homolog
• Host Species: Rabbit
• Molecular Weight of Antigen: 162 kDa
• Quantity: 100 μL
• Research Discipline: Zinc Finger
• Gene ID (Entrez): 23355
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: B9EIQ1
• Gene Symbols: VPS8
• Immunogen: Synthetic peptides corresponding to VPS8(vacuolar protein sorting 8 homolog (S. cerevisiae)) The peptide sequence was selected from the N terminal of VPS8. Peptide sequence CGFAKGQITMWDLASGKLLRSITDAHPPGTAILHIKFTDDPTLAICNDSG.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only