Learn More
Description
Specifications
Specifications
| Antigen | VSIG4 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Formulation | PBS, pH 7.2, 40% glycerol |
| Gene Alias | CRIg, Ig superfamily protein, Protein Z39Ig, V-set and immunoglobulin domain containing 4, V-set and immunoglobulin domain-containing protein 4, Z39IGcomplement receptor of the immunoglobulin superfamily |
| Host Species | Rabbit |
| Immunogen | This antibody has been engineered to specifically recognize the recombinant protein VSIG4 using the following amino acid sequence: KGDVNLPCTYDPLQGYTQVLVKWLVQRGSDPVTIFLRDSSGDHIQQAKYQGRLHVSHKVPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVV |
| Purification Method | Affinity purified |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
