Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NB036206

WASF1/WAVE1 Antibody, Novus Biologicals™
SDP

Catalog No. NB036206 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB036206 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB036206 Supplier Novus Biologicals Supplier No. NBP288584
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

WASF1/WAVE1 Polyclonal specifically detects WASF1/WAVE1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen WASF1/WAVE1
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Formulation PBS, 2% Sucrose
Gene Alias KIAA0269WAVEhomology of dictyostelium scar 1, Protein WAVE-1, SCAR1WASP family protein member 1, Verprolin homology domain-containing protein 1, WAS protein family, member 1, WAVE1FLJ31482, wisk
Host Species Rabbit
Immunogen The immunogen is a synthetic peptide directed towards the following sequence TPYRDDGKEGLKFYTNPSYFFDLWKEKMLQDTEDKRKEKRKQKQKNLDRP
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Phospho Specific
Primary or Secondary Primary
Gene ID (Entrez) 8936
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.